Pay in 4 interest-free payments of $31.80 Learn more
Ships within 48 hours · Estimated delivery Jul 27 - Aug 1
hepatic and renal abnormalities
Extra Notes: Immunofluorescence analysis of L929 using TRIM45 antibody at dilution of 1:100
KIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFML
PubMed:26344097
Androgen Receptor Monoclonal Antibody-MB66174 Size:100µl hepatic and renal abnormalitiesAndrogen Receptor Monoclonal Antibody Sizes: 50l, 100l Catalogue Numbers: MB66174 50, MB66174 100 Product: Mouse IgG2b. Liquid in PBS containing 50% glycerol, 0. 2% BSA and 0. 01% sodium azide. Swiss Prot: P10275 Host: Mouse Reactivity: Human Applications: WB, IHC All Applications: WB (1 500 1 1000), IHC (1 100 1 300) Background: Androgen receptor (AR), a zinc finger transcription factor belonging to the nuclear receptor superfamily, is activated by
US$ 225.00
US$ 15.95
US$ 15.95
US$ 700.00
US$ 110.00
US$ 532.00